PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr4P07450_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 303aa    MW: 33109.1 Da    PI: 8.4804
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr4P07450_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox308.9e-101121491954
                            HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  GSMUA_Achr4P07450_001 112 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 149
                            554458******************************88 PP

2BELL68.21.5e-221433072
                   BELL 30 lqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                           +q+v++sF+ v+g g+a+pYt+lA+ka+SrhFrcLkdai+ q+
  GSMUA_Achr4P07450_001  1 MQMVVNSFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIVAQL 43
                           9***************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075261.1E-18140IPR006563POX domain
PROSITE profilePS5007112.35790153IPR001356Homeobox domain
CDDcd000862.60E-1393154No hitNo description
SMARTSM003891.1E-893157IPR001356Homeobox domain
SuperFamilySSF466892.35E-1794159IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.604.2E-2896159IPR009057Homeodomain-like
PfamPF059201.2E-18110149IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MQMVVNSFDS VMGFGAATPY TALAQKAMSR HFRCLKDAIV AQLKQTCELL GDREGASSSG  60
ITKGDTPRLR LLDQSLRQQQ SFSQMGMMEQ EAWRPQRGLP ERSVSILRGW LFEHFLHPYP  120
SDADKHLLAR QTGLSRNQVS NWFINARVRL WKPMVEEMYL QESKEEEGTE KEANQQRAPS  180
PMQQQQQSQR LGTNAASESD ASPSTSSISH RNHRFASSSD NPPPGLGAAH QPSSGVDDGV  240
LVGVGQIGDV YRYYGAAATS ELGPAARMRL GAAGDVSLTL GLRHAGGGTS EKSRFSVRDL  300
GGC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A2e-1699156158Homeobox protein Meis1
4xrs_B2e-1699156158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009395654.10.0PREDICTED: BEL1-like homeodomain protein 4
SwissprotQ94KL51e-106BLH4_ARATH; BEL1-like homeodomain protein 4
TrEMBLM0SLW20.0M0SLW2_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P07450_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.22e-88BEL1-like homeodomain 2